PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_13.181
Common NamePFL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family LFY
Protein Properties Length: 336aa    MW: 38003.9 Da    PI: 7.0496
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_13.181genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY192.43.2e-5911521156
                       FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdm 81 
                                   mdp+ fs+slfkwdp   ++++p rlle  a  +ap++aa  +  r+l +leelf++yG+ry+t+akiaelGft+stLvdm
  evm.model.supercontig_13.181   1 MDPDGFSSSLFKWDPTRGIVQAPVRLLEAVA--AAPTQAAYGVRPRELGGLEELFQDYGIRYFTAAKIAELGFTASTLVDM 79 
                                   9*************88888888888876655..4454678888899999******************************** PP

                       FLO_LFY  82 kdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqe 156
                                   kdeeld++m+sls+ifr++llvGeryGikaavraerrrl++++  ++rr++ls+d+++aldalsqegl+   ++e
  evm.model.supercontig_13.181  80 KDEELDEMMNSLSQIFRWELLVGERYGIKAAVRAERRRLDDDD--SRRRQTLSTDTTHALDALSQEGLKVVGEEE 152
                                   *****************************************77..888889****************76433222 PP

2FLO_LFY397.41.7e-121150321214385
                       FLO_LFY 214 dedeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkaga 294
                                   +e++e+++ +g+erqrehPfivtepgevargkknGLDYLf+LyeqCr+fL+qvq+iakerGekcPtkvtnqvfryakkaga
  evm.model.supercontig_13.181 150 EEEQEEENGGGSERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKCPTKVTNQVFRYAKKAGA 230
                                   445555666789********************************************************************* PP

                       FLO_LFY 295 syinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLr 375
                                   syinkPkmrhYvhCYalhcLde++snalr afkergenvG+wrqacykplvaiaarqgwdida+fnahprL+iWYvP kLr
  evm.model.supercontig_13.181 231 SYINKPKMRHYVHCYALHCLDEKESNALRTAFKERGENVGSWRQACYKPLVAIAARQGWDIDAIFNAHPRLAIWYVPNKLR 311
                                   ********************************************************************************* PP

                       FLO_LFY 376 qLChlerska 385
                                   qLCh+er+++
  evm.model.supercontig_13.181 312 QLCHAERNNT 321
                                   *******987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-621155IPR002910Floricaula/leafy protein
PfamPF016984.7E-118151321IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MDPDGFSSSL FKWDPTRGIV QAPVRLLEAV AAAPTQAAYG VRPRELGGLE ELFQDYGIRY  60
FTAAKIAELG FTASTLVDMK DEELDEMMNS LSQIFRWELL VGERYGIKAA VRAERRRLDD  120
DDSRRRQTLS TDTTHALDAL SQEGLKVVGE EEQEEENGGG SERQREHPFI VTEPGEVARG  180
KKNGLDYLFH LYEQCRDFLI QVQNIAKERG EKCPTKVTNQ VFRYAKKAGA SYINKPKMRH  240
YVHCYALHCL DEKESNALRT AFKERGENVG SWRQACYKPL VAIAARQGWD IDAIFNAHPR  300
LAIWYVPNKL RQLCHAERNN TAIASTSAAA HHLPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1101603202162PROTEIN LEAFY
2vy2_A1e-1101603202162PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0547940.0DQ054794.1 Carica papaya FLORICULA/LEAFY-like protein (PFL) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004501760.10.0PREDICTED: protein UNIFOLIATA
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLQ4TVN50.0Q4TVN5_CARPA; FLORICULA/LEAFY-like protein
STRINGVIT_17s0000g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Representative plantOGRP70181619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-103floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Yu Q,Moore PH,Albert HH,Roader AH,Ming R
    Cloning and characterization of a FLORICAULA/LEAFY ortholog, PFL, in polygamous papaya.
    Cell Res., 2005. 15(8): p. 576-84
    [PMID:16117847]